Loading...
Statistics
Advertisement

ghinwatv.com - Diese Website steht zum Verkauf! -& ...
www.ghinwatv.com/
Diese

Ghinwatv.com

Domain is redirected to: Ww1.ghinwatv.com
Advertisement
Ghinwatv.com is hosted in United States / Cambridge . Ghinwatv.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: Html, Html5, Javascript, Number of used javascripts: 3. First javascripts: Jquery-1.11.3.custom.min.js, Caf.js, Iam.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Ghinwatv.com

Technology

Number of occurences: 5
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 3
  • jquery-1.11.3.custom.min.js
  • caf.js
  • iam.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache

Powered by

  • PHP/5.4.45-0+deb7u4

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ghinwatv.com

Missing HTTPS protocol.

    Meta - Ghinwatv.com

    Number of occurences: 5
    • Name:
      Content: 0; url=http://ww1.ghinwatv.com//?gtnjs=1
    • Name: GOOGLEBOT
      Content: index, follow, all
    • Name: robots
      Content: index, follow, all
    • Name: viewport
      Content: width=device-width,initial-scale=1,maximum-scale=1,user-scalable=0
    • Name: description
      Content: Diese

    Server / Hosting

    • IP: 72.52.4.90
    • Latitude: 42.36
    • Longitude: -71.08
    • Country: United States
    • City: Cambridge

    Rname

    • ns2.above.com
    • ns1.above.com
    • mail.post-host.net

    Target

    • hostmaster.trellian.com

    HTTP Header Response

    HTTP/1.1 302 Found Date: Mon, 15 Aug 2016 11:34:13 GMT Server: Apache X-Powered-By: PHP/5.4.45-0+deb7u4 Set-Cookie: __tad=1471260853.4839990; expires=Thu, 13-Aug-2026 11:34:13 GMT Location: http://ww1.ghinwatv.com/ Content-Length: 0 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 OK Date: Mon, 15 Aug 2016 11:34:14 GMT Server: Apache/2.2.22 (Debian) X-Powered-By: PHP/5.6.22-1~dotdeb+7.1 Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Mon, 15 Aug 2016 11:34:14 GMT Cache-Control: no-store, no-cache, must-revalidate Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: tu=97745f407a1ebd847c7dda94a3fe65b6; expires=Tue, 31-Dec-2019 23:00:00 GMT; Max-Age=106572346; path=/; domain=ghinwatv.com; httponly X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBANnylWw2vLY4hUn9w06zQKbhKBfvjFUCsdFlb6TdQhxb9RXWXuI4t31c+o8fYOv/s8q1LGPga3DE1L/tHU4LENMCAwEAAQ==_JsB78uEDy4Pv/N8pu4vBbYn3a7V4b1kaiaBsU8Gcisovagw1QI3JJ8w3zwGALZz26WRF6VzFkRLhO0IsbdqOdA== Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from 440444 Set-Cookie: NSC_tfep-83+63+5+01-91=ffffffff516a73d445525d5f4f58455e445a4a423660;path=/;httponly X-Cache: MISS from s_fl343 X-Cache-Lookup: MISS from s_fl343:80 Transfer-Encoding: chunked Via: 1.1 s_fl343 (squid/3.5.9) Connection: keep-alive

    DNS

    host: ghinwatv.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 103.224.182.210
    host: ghinwatv.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.above.com
    host: ghinwatv.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.above.com
    host: ghinwatv.com
    1. class: IN
    2. ttl: 60
    3. type: SOA
    4. mname: ns1.above.com
    5. rname: hostmaster.trellian.com
    6. serial: 2016081501
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: ghinwatv.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 1
    5. target: mail.post-host.net
    host: ghinwatv.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: v=spf1 ip6:fdcf:abda:4154::/48 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.hinwatv.com, www.gshinwatv.com, www.shinwatv.com, www.gxhinwatv.com, www.xhinwatv.com, www.gyhinwatv.com, www.yhinwatv.com, www.ghhinwatv.com, www.hhinwatv.com, www.gnhinwatv.com, www.nhinwatv.com, www.gchinwatv.com, www.chinwatv.com, www.gdhinwatv.com, www.dhinwatv.com, www.gehinwatv.com, www.ehinwatv.com, www.grhinwatv.com, www.rhinwatv.com, www.gthinwatv.com, www.thinwatv.com, www.gbhinwatv.com, www.bhinwatv.com, www.gvhinwatv.com, www.vhinwatv.com, www.ginwatv.com, www.gheinwatv.com, www.geinwatv.com, www.ghdinwatv.com, www.gdinwatv.com, www.ghcinwatv.com, www.gcinwatv.com, www.ghuinwatv.com, www.guinwatv.com, www.ghjinwatv.com, www.gjinwatv.com, www.ghinwatv.com, www.ginwatv.com, www.ghbinwatv.com, www.gbinwatv.com, www.ghginwatv.com, www.gginwatv.com, www.ghnwatv.com, www.ghirnwatv.com, www.ghrnwatv.com, www.ghifnwatv.com, www.ghfnwatv.com, www.ghivnwatv.com, www.ghvnwatv.com, www.ghiknwatv.com, www.ghknwatv.com, www.ghi,nwatv.com, www.gh,nwatv.com, www.ghibnwatv.com, www.ghbnwatv.com, www.ghignwatv.com, www.ghgnwatv.com, www.ghitnwatv.com, www.ghtnwatv.com, www.ghiynwatv.com, www.ghynwatv.com, www.ghiunwatv.com, www.ghunwatv.com, www.ghijnwatv.com, www.ghjnwatv.com, www.ghimnwatv.com, www.ghmnwatv.com, www.ghinnwatv.com, www.ghnnwatv.com, www.ghiwatv.com, www.ghinnwatv.com, www.ghinwatv.com, www.ghinhwatv.com, www.ghihwatv.com, www.ghinjwatv.com, www.ghijwatv.com, www.ghinkwatv.com, www.ghikwatv.com, www.ghinlwatv.com, www.ghilwatv.com, www.ghin watv.com, www.ghi watv.com, www.ghinatv.com, www.ghinw atv.com, www.ghin atv.com, www.ghinwcatv.com, www.ghincatv.com, www.ghinwatv.com, www.ghinatv.com, www.ghinwdatv.com, www.ghindatv.com, www.ghinwfatv.com, www.ghinfatv.com, www.ghinwgatv.com, www.ghingatv.com, www.ghinwbatv.com, www.ghinbatv.com, www.ghinwtv.com, www.ghinwaotv.com, www.ghinwotv.com, www.ghinwaptv.com, www.ghinwptv.com, www.ghinwa9tv.com, www.ghinw9tv.com, www.ghinwatv.com, www.ghinwtv.com, www.ghinwaitv.com, www.ghinwitv.com, www.ghinwautv.com, www.ghinwutv.com, www.ghinwav.com, www.ghinwatqv.com, www.ghinwaqv.com, www.ghinwatav.com, www.ghinwaav.com, www.ghinwat v.com, www.ghinwa v.com, www.ghinwatwv.com, www.ghinwawv.com, www.ghinwatev.com, www.ghinwaev.com, www.ghinwatzv.com, www.ghinwazv.com, www.ghinwatxv.com, www.ghinwaxv.com, www.ghinwatcv.com, www.ghinwacv.com, www.ghinwat.com, www.ghinwatvy.com, www.ghinwaty.com, www.ghinwatvz.com, www.ghinwatz.com, www.ghinwatvh.com, www.ghinwath.com, www.ghinwatvn.com, www.ghinwatn.com, www.ghinwatvm.com, www.ghinwatm.com, www.ghinwatvj.com, www.ghinwatj.com, www.ghinwatvk.com, www.ghinwatk.com, www.ghinwatvi.com, www.ghinwati.com,

    Other websites we recently analyzed

    1. The Art of Jonathan Rowan
      Chesterfield (United States) - 216.35.196.26
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Pingback, Wordpress
      Number of meta tags: 2
    2. Fotograf Anders Loberg
      fotograf Anders Loberg
      Copenhagen (Denmark) - 212.97.132.113
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 4
    3. South Yorkshire Jobs - Dedicated to the South Yorkshire jobs market
      South Yorkshire Jobs - Job in the South Yorkshire area. If you are an employer looking to fill a vacancy, why not try South Yorkshire Jobs.
      Gloucester (United Kingdom) - 88.208.252.165
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, Javascript, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 3
    4. Louis Vuitton feedback
      Louis Vuitton Malletier, commonly referred to as Louis Vuitton, or shortened to LV, is a French fashion house founded in 1854 by Louis Vuitton.
      Boardman (United States) - 54.187.81.107
      G Analytics ID: UA-68128527-3
      Server software: nginx/1.6.2
      Technology: AJAX Libraries API, CSS, Fancybox, Html, Javascript, jQuery Fancybox, Google Analytics, New Relic
      Number of Javascript: 33
      Number of meta tags: 8
    5. 8756989.com
      Ottawa (Canada) - 47.90.14.232
      Server software: Microsoft-IIS/7.5
      Technology: Html, Php
      Number of Javascript: 1
      Number of meta tags: 1
    6. wollin.de
      Germany - 193.159.169.220
      Server software: Apache/2.2.8 (Ubuntu) mod_auth_tkt/2.0.0rc3 PHP/4.4.9 proxy_html/3.0.0 mod_ssl/2.2.8 OpenSSL/0.9.8g
      Technology: CSS, Html, Javascript, Php
      Number of meta tags: 1
    7. -秦皇岛天泽环保科技有限公司
      Mong Kok (Hong Kong) - 103.20.193.3
      Server software: IIS
      Technology: CSS, Html, Javascript, Php, Swf Object
      Number of Javascript: 8
      Number of meta tags: 3
    8. נטו זכוכית
      הבית שלכם עומד ועכשיו רק נשארו הפינישים "הקטנים" . חשבתם שכמעט סיימתם אבל עכשיו אתם מבינים שלמעשה אתם רק מתחילים. על מנת להשיג את הבית המושלם, אתם זקוקים לבעל מקצוע אשר ייתן את תשומת ליבו המלאה לכל פרט ופרט באורח חייכם.. אתם זקוקים לבעל מקצוע שמבין אסטטיקה ובעיקר אתם זקוקים לבעל מקצוע שאתם יכולים לסמוך עליו.
      Israel - 95.183.6.50
      Server software: Powered by STG
      Technology: CSS, Html, Javascript, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 3
    9. INDUSO-Individuelle Softwarelösungen
      Individuelle Softwarelösungen
      Höst (Germany) - 176.28.50.227
      G Analytics ID: UA-67275615-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 5
    10. milletvekiliadaylarihakkinda.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html

    Check Other Websites